DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and LOC101731658

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_031758165.1 Gene:LOC101731658 / 101731658 -ID:- Length:331 Species:Xenopus tropicalis


Alignment Length:330 Identity:66/330 - (20%)
Similarity:115/330 - (34%) Gaps:111/330 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 WFLD-KTQTNAHIAFFY--------IECVCNAWFTFEILVRFI--------------SSPNKWEF 274
            |.|: :|:....::|..        ..|:.|.  |.|:.::.:              |:...|.|
 Frog    37 WALESQTEVEQSVSFQQDKWELLRNFTCMDNR--TLELFIKTVIGAYKSGISPEGNSSNLGSWSF 99

  Fly   275 IKS---SVNIIDYI-------------------ATLSFYIDLVL-----QRFASHLEN-ADILEF 311
            ..|   ||.::..|                   |.....::|:|     |:..|.:.. .|::. 
 Frog   100 GGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGIPLNLILLNRIGQKMLSLVHRCGDVVG- 163

  Fly   312 FSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLV--YYAERIQPNPHN 374
             ..||..||.||.  :||..:||.           |:.|::|..|:|.::.  .|.|        
 Frog   164 -KRIRRQRLTKLV--TSGSALLIG-----------LLLFMLLPPVLFRAVEGWTYGE-------- 206

  Fly   375 DFNSIPLGLWWALVTMTTVGYGDMA---------PKTYIGMFVGALCALAGVLTIALPVPVIVSN 430
                   ||:::.:|:.|:|:||..         |..|..:.  ::..|.|:..:||.    ::.
 Frog   207 -------GLYYSFITLATIGFGDYVVGRNPDKQYPNWYRNLL--SVWILFGLAWLALG----INA 258

  Fly   431 FAMYYSHTQARAKLPKKRRRVLPVEQPRQPRLPGAPGGVSGCGTPGSGPHSGPMGSGGTGPRRMN 495
            .|....|.:.|....:|.:.....|:...   ||..|.:  |.|..|      ..|.....|.|:
 Frog   259 GADALEHCRERCPCRRKSKNQAAGEELMD---PGGEGSL--CCTKQS------EDSASNETRAMD 312

  Fly   496 NKTKD 500
            .:..|
 Frog   313 QRDAD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 50/255 (20%)
Ion_trans_2 355..429 CDD:285168 17/84 (20%)
LOC101731658XP_031758165.1 Ion_trans_2 92..151 CDD:400301 11/58 (19%)
Ion_trans_2 194..264 CDD:400301 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.