DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and LOC100537363

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_009301042.1 Gene:LOC100537363 / 100537363 -ID:- Length:856 Species:Danio rerio


Alignment Length:287 Identity:70/287 - (24%)
Similarity:118/287 - (41%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 KPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLD 236
            :||.|:.....|         |..:.|.|:.:..|.               |:|           
Zfish    87 RPRGWAFIYHAY---------VFLLVFSCLVLSVFS---------------TIK----------- 116

  Fly   237 KTQTNAHIAFFYIECVCNAWFTFEILVRFISS---------PNKWEFIKSSVNIIDYIATLSFYI 292
            :.:.::..|.:.:|.|....|..|.:||..|:         ..:.:|.:....:|| |..|...|
Zfish   117 EYEKSSEDALYILEIVTIVVFGVEYIVRIWSAGCCCRYRGWRGRLKFARKPFCVID-IMVLIASI 180

  Fly   293 DLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVI 357
            .::......::.....:.....::|:|:.::.|.....|:|.....|.:|||....:...|.:::
Zfish   181 SVLAAGTQGNVFATSAIRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLCLIL 245

  Fly   358 FASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIAL 422
            .:.|||.||:   ..:..|.:....|||.|:|:||:||||..|.|:.|..:.|...|.||...||
Zfish   246 ASFLVYLAEK---EDNEMFETYADALWWGLITLTTIGYGDKYPITWNGRLLAATFTLIGVSFFAL 307

  Fly   423 PVPVIVSNFAMYYSHTQARAKLPKKRR 449
            |..::.|.||:.... |.|.|..:|||
Zfish   308 PAGILGSGFALKVQE-QHRQKHFEKRR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 54/203 (27%)
Ion_trans_2 355..429 CDD:285168 27/73 (37%)
LOC100537363XP_009301042.1 Ion_trans 119..324 CDD:278921 54/209 (26%)
Ion_trans_2 240..314 CDD:285168 28/76 (37%)
KCNQ_channel 444..646 CDD:281513
KCNQ2_u3 655..735 CDD:293248
KCNQC3-Ank-G_bd 766..853 CDD:288784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.