DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kcnc1

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_031756512.1 Gene:kcnc1 / 100497402 XenbaseID:XB-GENE-996920 Length:644 Species:Xenopus tropicalis


Alignment Length:300 Identity:146/300 - (48%)
Similarity:198/300 - (66%) Gaps:21/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 IGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNA 255
            :...|:|||.:||.:|||:||......:.:..|....|.:...|..:::|.|.:.  |||.||..
 Frog   261 VAFASLFFILVSITTFCLETHETFNPIVNKTETEVVGNETQLRFYRESETEAFLT--YIEGVCVV 323

  Fly   256 WFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSI---IRI 317
            |||||.|:|....|||.||||:::||||::|.|.||:::.|...:|.... |:|.|..:   :||
 Frog   324 WFTFEFLMRITFCPNKVEFIKNTLNIIDFVAILPFYLEVGLSGLSSKAAK-DVLGFLRVVRFVRI 387

  Fly   318 MRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNP-------HND 375
            :|:||||||..||::|..|.|||..|..||:.||.||::|||:::||||||..||       |..
 Frog   388 LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPSASEHTQ 452

  Fly   376 FNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 440
            |.:||:|.|||:|||||:|||||.|||:.||.||||||||||||||:||||||:||.||||...|
 Frog   453 FKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 517

  Fly   441 RAKLPKKRRRVLPVEQPRQPRLPGAPGGVSGCGTPGSGPH 480
            :.|||||:::.:    ||.|:| |:|   :.|.:..:.||
 Frog   518 KQKLPKKKKKHI----PRPPQL-GSP---NYCKSVVNSPH 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 115/204 (56%)
Ion_trans_2 355..429 CDD:285168 53/80 (66%)
kcnc1XP_031756512.1 LLB_putidacin <49..>94 CDD:411188
Ion_trans 259..516 CDD:395416 131/257 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 247 1.000 Domainoid score I2104
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D331021at33208
OrthoFinder 1 1.000 - - FOG0000990
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11537
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.