DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kcnk2

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:137 Identity:28/137 - (20%)
Similarity:56/137 - (40%) Gaps:43/137 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 TRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVY---YAER----IQPN----PHNDFN 377
            ||.:..:.:.:..::..:....::|.:|::|..:|.:|..   .|:|    ||.|    .|:..|
 Frog    32 TRDNREITMNVMKWKTVSTVFLVVVLYLIIGATVFKALEQPHESAQRTTIVIQKNNFILNHSCVN 96

  Fly   378 ------------------SIPLG--------------LWWALVTMTTVGYGDMAPKTYIGMFVGA 410
                              .||:|              .::|...:||:|:|:::|:|..|.....
 Frog    97 VTELDELIQQLMAAINAGIIPIGNTSHQNSHWDLGSSFFFAGTVITTIGFGNISPRTKGGKIFCI 161

  Fly   411 LCALAGV 417
            :.||.|:
 Frog   162 IYALLGI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 28/137 (20%)
Ion_trans_2 355..429 CDD:285168 23/106 (22%)
kcnk2XP_031758740.1 Ion_trans_2 <128..182 CDD:400301 11/41 (27%)
Ion_trans_2 220..298 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X19
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.