DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shaw and kctd9

DIOPT Version :9

Sequence 1:NP_001137782.1 Gene:Shaw / 33599 FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_001120488.1 Gene:kctd9 / 100145607 XenbaseID:XB-GENE-976411 Length:389 Species:Xenopus tropicalis


Alignment Length:133 Identity:40/133 - (30%)
Similarity:60/133 - (45%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVLNVGGIRHETYKATL-KKIPATRLSRL---TEALANYDPILNEYFFDRHPGVFAQVLNYYRTG 87
            :.|||||....|.::|| .|.|.:.||.:   .:|..|.......:..||.|..|..:|||.|.|
 Frog    91 LTLNVGGRYFTTTRSTLVSKEPDSMLSHMFSDRDAWGNKKDHTGAFLIDRSPEYFEPILNYLRHG 155

  Fly    88 KL--HYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKP-SEEE 149
            :|  :...::.|.|  ||.:|:|:||          ..:|.:    ||:.:....|...| |.:|
 Frog   156 QLIVNDGVNLLGVL--EEAKFFGIDS----------LIEHLE----LAIKNSQPADDHSPISRKE 204

  Fly   150 LAR 152
            ..|
 Frog   205 FIR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585 32/103 (31%)
BTB_2 27..117 CDD:280393 32/95 (34%)
Ion_trans 244..439 CDD:278921
Ion_trans_2 355..429 CDD:285168
kctd9NP_001120488.1 KHA 2..64 CDD:288667
BTB 90..191 CDD:197585 35/115 (30%)
BTB 91..181 CDD:295341 32/101 (32%)
Pentapeptide 219..251 CDD:279183
Pentapeptide_4 240..325 CDD:290330
Pentapeptide 243..280 CDD:279183
Pentapeptide 303..342 CDD:279183
Pentapeptide_4 310..384 CDD:290330
Pentapeptide 338..377 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.