DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2818 and GDPD3

DIOPT Version :10

Sequence 1:NP_608804.1 Gene:CG2818 / 33597 FlyBaseID:FBgn0031566 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_077283.2 Gene:GDPD3 / 79153 HGNCID:28638 Length:318 Species:Homo sapiens


Alignment Length:167 Identity:49/167 - (29%)
Similarity:72/167 - (43%) Gaps:51/167 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 HR-GSGTSFKAKDAVIRENTITSLKNAAEHGADMVEFDVQLSKDLVPVVYHDFMIYVSLKSKC-- 436
            || |||.        :.|||:.:::|:....:|::|.|.||::|.|.||.||       ::.|  
Human    44 HRGGSGE--------LLENTMEAMENSMAQRSDLLELDCQLTRDRVVVVSHD-------ENLCRQ 93

  Fly   437 SLQEHDFLALPMRELSLEQLKKLKVY----HIAEGLSRETRSFHNDDCLEHQPFPQLCDVLDALD 497
            |....|..:|...:|.|.: :||:||    |.|.|..|  |....:|..  |.||:         
Human    94 SGLNRDVGSLDFEDLPLYK-EKLEVYFSPGHFAHGSDR--RMVRLEDLF--QRFPR--------- 144

  Fly   498 VHVGFNIEIKWSQRLEDGKMEEEFEHVV------DRN 528
              ...::|||       ||.||....:.      |||
Human   145 --TPMSVEIK-------GKNEELIREIAGLVRRYDRN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2818NP_608804.1 CBM20_Prei4 44..166 CDD:99888
GDPD_GDE5 371..659 CDD:176549 49/167 (29%)
GDPD3NP_077283.2 GDPD_GDE4 13..310 CDD:176553 49/167 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.