DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2818 and GDPD2

DIOPT Version :10

Sequence 1:NP_608804.1 Gene:CG2818 / 33597 FlyBaseID:FBgn0031566 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_001164663.1 Gene:GDPD2 / 54857 HGNCID:25974 Length:590 Species:Homo sapiens


Alignment Length:225 Identity:56/225 - (24%)
Similarity:81/225 - (36%) Gaps:61/225 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 VGHRGSGTSFKAKDAVIRENTITSLKNAAEHGADMVEFDVQLSKDLVPVVYHDFMIYVSLKSKCS 437
            |||||:       ..:..|||:.||:..||.||.:.|.||.:|.|.||.:.||        ...|
Human   227 VGHRGA-------PMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHD--------EHLS 276

  Fly   438 LQEHDFLALPMR------ELSLEQLKKLKVYHIAEGLSRETRSFHNDDCL--------EHQPFPQ 488
            ...:.....|.|      :.|..:||:|.    |.....|.|.|.....|        |.|..|.
Human   277 RTTNVASVFPTRITAHSSDFSWTELKRLN----AGSWFLERRPFWGAKPLAGPDQKEAESQTVPA 337

  Fly   489 LCDVLD---ALDVHVGFNIEIKWSQRLEDGKMEEEFEHVVDRNLYIDCI----LDVILRKAGNRR 546
            |.::|:   ||::.:.|::                 ......:.|.|..    |:.:|.....:.
Human   338 LEELLEEAAALNLSIMFDL-----------------RRPPQNHTYYDTFVIQTLETVLNARVPQA 385

  Fly   547 IVLSCFDPDICTILRFKQNRYPVMFLTLGR 576
            :|....|.|...:    |.|.|.|....||
Human   386 MVFWLPDEDRANV----QRRAPGMRQIYGR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2818NP_608804.1 CBM20_Prei4 44..166 CDD:99888
GDPD_GDE5 371..659 CDD:176549 56/225 (25%)
GDPD2NP_001164663.1 PI-PLCc_GDPD_SF 202..563 CDD:472694 56/225 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.