DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and TFPI2

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:59 Identity:24/59 - (40%)
Similarity:30/59 - (50%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            |..|....|..|...|.|...|..|.:||..|.|:.|.|.|||||||.|.::.:|:..|
Human   150 APKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRAC 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 21/50 (42%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659
Kunitz_BPTI 95..149 CDD:425421
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658 20/48 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.