DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Spint4

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_084334.1 Gene:Spint4 / 78239 MGIID:1925489 Length:159 Species:Mus musculus


Alignment Length:85 Identity:26/85 - (30%)
Similarity:37/85 - (43%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGLLLLI----PHHSGAASKRVKL-------CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGG 63
            |:||.||.    |..||.......|       ||..:..|.|:.....:.||...:.|:.|::.|
Mouse     9 LLGLSLLCSLSPPVLSGVERLANYLCKDYNDPCLLDVEPGSCYEVHFRFFYNQTAKQCQIFLFTG 73

  Fly    64 CGGNDNRFSTKAECEFNCRD 83
            |.||.|.|..|.:|:..|.:
Mouse    74 CNGNLNNFKLKIDCDVTCHE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 16/50 (32%)
Spint4NP_084334.1 KU 39..91 CDD:238057 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6867
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.