DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and spint2

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:54 Identity:20/54 - (37%)
Similarity:26/54 - (48%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI 84
            ||...::|.|....|.:.|||..:.||.|.||||.||.|....:..|...|..:
 Frog   119 CLPEAVTGPCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKCAGV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 19/49 (39%)
spint2NP_001039077.1 MANEC 19..104 CDD:471454
Kunitz-type 117..169 CDD:444694 19/49 (39%)
Kunitz-type 195..246 CDD:444694
Kunitz-type 266..318 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.