DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2816 and Wfdc8

DIOPT Version :9

Sequence 1:	NP_608803.2	Gene:	CG2816 / 33595	FlyBaseID:	FBgn0031564	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001292357.1	Gene:	Wfdc8 / 685170	RGDID:	1597713	Length:	237	Species:	Rattus norvegicus

Alignment Length:	51	Identity:	20/51 - (39%)
Similarity:	27/51 - (52%)	Gaps:	0/51 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            ||.|..:|.|...:..:.::..|..|..|.|.|||||.|.|.:||:|...|
  Rat    91 CLLPSDAGNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNAC 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2816	NP_608803.2	Kunitz_BPTI	31..82	CDD:278443	20/51 (39%)
Wfdc8	NP_001292357.1	WAP	45..86	CDD:278522
		Kunitz_BPTI	90..142	CDD:278443	20/51 (39%)
		WAP	<145..186	CDD:294103
		WAP	195..235	CDD:278522
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810