powered by:
Protein Alignment CG2816 and Wfdc8
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001292357.1 |
Gene: | Wfdc8 / 685170 |
RGDID: | 1597713 |
Length: | 237 |
Species: | Rattus norvegicus |
Alignment Length: | 51 |
Identity: | 20/51 - (39%) |
Similarity: | 27/51 - (52%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
||.|..:|.|...:..:.::..|..|..|.|.|||||.|.|.:||:|...|
Rat 91 CLLPSDAGNCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNAC 141
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.