DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Spint3

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_006235690.1 Gene:Spint3 / 685136 RGDID:1597746 Length:87 Species:Rattus norvegicus


Alignment Length:52 Identity:18/52 - (34%)
Similarity:28/52 - (53%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            :|..||..|.|......:.|:...:.|:.|.||||.||:|.|.::.:|:..|
  Rat    33 MCTLPMEKGECRAIFVRWYYDTKTKKCDWFHYGGCRGNENNFLSRNQCQTVC 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 18/51 (35%)
Spint3XP_006235690.1 KU 34..84 CDD:238057 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49543
OrthoDB 1 1.010 - - D1564520at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.