DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Spint3

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:52 Identity:19/52 - (36%)
Similarity:28/52 - (53%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            :|:.|...|.|......:.||.....||.|.||||.||:|.|.::::|:..|
Mouse    34 MCILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 19/51 (37%)
Spint3NP_001170872.1 Kunitz_BPTI 35..85 CDD:278443 18/49 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49543
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.