| Sequence 1: | NP_608803.2 | Gene: | CG2816 / 33595 | FlyBaseID: | FBgn0031564 | Length: | 84 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001070718.2 | Gene: | spint2 / 562009 | ZFINID: | ZDB-GENE-061013-323 | Length: | 431 | Species: | Danio rerio |
| Alignment Length: | 51 | Identity: | 22/51 - (43%) |
|---|---|---|---|
| Similarity: | 30/51 - (58%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2816 | NP_608803.2 | Kunitz_SCI-I-like | 30..81 | CDD:438677 | 21/49 (43%) |
| spint2 | NP_001070718.2 | MANEC | <56..108 | CDD:471454 | |
| Kunitz-type | 133..183 | CDD:438633 | 21/49 (43%) | ||
| Kunitz-type | 228..276 | CDD:438633 | |||
| Kunitz-type | 302..354 | CDD:444694 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||