DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and si:dkey-117n7.5

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001038359.1 Gene:si:dkey-117n7.5 / 559444 ZFINID:ZDB-GENE-060503-331 Length:172 Species:Danio rerio


Alignment Length:62 Identity:29/62 - (46%)
Similarity:37/62 - (59%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            ||.......:|||:||..|.|..||..:.|..:...|.||:|||||||.||||:|.:|:..|
Zfish   102 HSVNVDSAAELCLEPMSEGHCTEYVLLWYYYAVSGECRPFVYGGCGGNGNRFSSKQDCQSTC 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 26/51 (51%)
si:dkey-117n7.5NP_001038359.1 Kunitz_BPTI 113..163 CDD:278443 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9845
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564520at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - oto40833
orthoMCL 1 0.900 - - OOG6_140696
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17313
SonicParanoid 1 1.000 - - X627
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.