powered by:
Protein Alignment CG2816 and si:dkey-117n7.5
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038359.1 |
Gene: | si:dkey-117n7.5 / 559444 |
ZFINID: | ZDB-GENE-060503-331 |
Length: | 172 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 29/62 - (46%) |
Similarity: | 37/62 - (59%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 HSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
||.......:|||:||..|.|..||..:.|..:...|.||:|||||||.||||:|.:|:..|
Zfish 102 HSVNVDSAAELCLEPMSEGHCTEYVLLWYYYAVSGECRPFVYGGCGGNGNRFSSKQDCQSTC 163
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
67 |
1.000 |
Domainoid score |
I9845 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564520at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto40833 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_140696 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R17313 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X627 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.850 |
|
Return to query results.
Submit another query.