DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and axo

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001246631.1 Gene:axo / 43923 FlyBaseID:FBgn0262870 Length:2179 Species:Drosophila melanogaster


Alignment Length:61 Identity:26/61 - (42%)
Similarity:33/61 - (54%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGN-DNRFSTKAECEFNC 81
            |..|.:.:.|..|...|.|..|:..:.|.|....|..||:|||.|| .|||.|:|||.|:|
  Fly   110 GQKSNQYEKCAGPGDPGPCKQYIYKWRYEPTTNECTNFIWGGCEGNPQNRFGTEAECLFHC 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 23/51 (45%)
axoNP_001246631.1 Kunitz-type 119..170 CDD:438633 23/50 (46%)
Laminin_G_2 275..413 CDD:460494
EGF_CA 433..476 CDD:238011
Laminin_G_2 514..640 CDD:460494
Laminin_G_2 698..817 CDD:460494
EGF_CA 842..878 CDD:238011
Laminin_G_2 1112..1240 CDD:460494
EGF_CA 1256..1297 CDD:238011
Laminin_G_2 1351..1503 CDD:460494
Laminin_G_2 1612..1733 CDD:460494
PHA03247 <1895..2164 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.