powered by:
Protein Alignment CG2816 and Y55F3BR.11
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001041041.2 |
Gene: | Y55F3BR.11 / 4363075 |
WormBaseID: | WBGene00044757 |
Length: | 125 |
Species: | Caenorhabditis elegans |
Alignment Length: | 34 |
Identity: | 10/34 - (29%) |
Similarity: | 13/34 - (38%) |
Gaps: | 9/34 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 RCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFS 72
|..|||:..|.: .:.| |..||...|
Worm 91 RVNGYVDDRATS-----MDTF----CAVNDINLS 115
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2816 | NP_608803.2 |
Kunitz_BPTI |
31..82 |
CDD:278443 |
10/34 (29%) |
Y55F3BR.11 | NP_001041041.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.