DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and CG34276

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:72 Identity:24/72 - (33%)
Similarity:38/72 - (52%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTK 74
            |:.||:.....|.:..:|   ||||:..|:...|:.::.||...:.|:.||:.|...|.|.|:|:
  Fly     8 LLILLVFCLQQSYSIKRR---CLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQ 69

  Fly    75 AECEFNC 81
            |.|...|
  Fly    70 ARCHKIC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 18/50 (36%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 18/49 (37%)

Return to query results.
Submit another query.