DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2816 and Wfdc6b

DIOPT Version :9

Sequence 1:	NP_608803.2	Gene:	CG2816 / 33595	FlyBaseID:	FBgn0031564	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	NP_001008867.1	Gene:	Wfdc6b / 408225	RGDID:	1303277	Length:	182	Species:	Rattus norvegicus

Alignment Length:	52	Identity:	21/52 - (40%)
Similarity:	26/52 - (50%)	Gaps:	0/52 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 LCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            :|..|..:|.|..|:..:.||.....|..||||||.||.|.|.:|..|...|
  Rat    76 ICSLPQDAGPCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 127

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2816	NP_608803.2	Kunitz_BPTI	31..82	CDD:278443	21/51 (41%)
Wfdc6b	NP_001008867.1	WAP	32..71	CDD:278522
Wfdc6b	NP_001008867.1	Kunitz_BPTI	76..127	CDD:278443	20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X627
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.810