powered by:
Protein Alignment CG2816 and Wfdc13
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001012722.1 |
Gene: | Wfdc13 / 408190 |
MGIID: | 3582777 |
Length: | 81 |
Species: | Mus musculus |
Alignment Length: | 76 |
Identity: | 20/76 - (26%) |
Similarity: | 25/76 - (32%) |
Gaps: | 26/76 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 LLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAE-- 76
|||: :.|..||:: |....|...|...|.....|| |.| |.|.|:.|
Mouse 9 LLLV----------LSLAPQPVL-GSPKQYFLKYILEPPPCRSEP---GAC----NMFCTQQEEC 55
Fly 77 ------CEFNC 81
|...|
Mouse 56 PEPLQCCSAYC 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2816 | NP_608803.2 |
Kunitz_BPTI |
31..82 |
CDD:278443 |
16/59 (27%) |
Wfdc13 | NP_001012722.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.