DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and IM33

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001285594.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster


Alignment Length:45 Identity:22/45 - (48%)
Similarity:32/45 - (71%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRD 83
            :|..::.|::|:|....||.|||||||||:|||.|:..||..|::
  Fly    38 KCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKCKE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 21/42 (50%)
IM33NP_001285594.1 KU 23..81 CDD:238057 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.