DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and APLP1

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001019978.1 Gene:APLP1 / 333 HGNCID:597 Length:651 Species:Homo sapiens


Alignment Length:34 Identity:11/34 - (32%)
Similarity:13/34 - (38%) Gaps:12/34 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFG 42
            ||:.||||:            |..||.|.....|
Human    22 LLLPLLLLL------------LRAQPAIGSLAGG 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 4/12 (33%)
APLP1NP_001019978.1 A4_EXTRA 46..211 CDD:128326
GFLD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 50..146
APP_N 55..154 CDD:280358
CuBD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 154..212
APP_Cu_bd 156..211 CDD:289676
Copper-binding. /evidence=ECO:0000250 158..178
Zinc-binding 204..211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..287
APP_E2 285..467 CDD:289677
O-glycosylated at three sites 285..305
Heparin-binding. /evidence=ECO:0000250 310..342
Heparin-binding. /evidence=ECO:0000250 410..441
Collagen-binding. /evidence=ECO:0000250 442..459
APP_amyloid 597..648 CDD:287486
Basolateral sorting signal. /evidence=ECO:0000250 605..616
Interaction with DAB1. /evidence=ECO:0000250 633..650
Interaction with DAB2. /evidence=ECO:0000250 637..651
Clathrin-binding. /evidence=ECO:0000255 641..644
NPXY motif, contains endocytosis signal 641..644
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.