DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Acp24A4

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:74 Identity:24/74 - (32%)
Similarity:38/74 - (51%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGLLLLIPHHSGAASKRVKLC-LQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFS 72
            ||:.|.:.|...|.:.:.:.::| |....:|.|......::|:.....|..||||||.||:|.|.
  Fly     3 LLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNVCFNFIYGGCQGNENSFE 67

  Fly    73 TKAECEFNC 81
            ::.||...|
  Fly    68 SQEECINKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 19/52 (37%)
Acp24A4NP_001036330.1 Kunitz_BPTI 24..77 CDD:278443 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.