DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Col28a1

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:51 Identity:17/51 - (33%)
Similarity:25/51 - (49%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            |.:.:..|.|..||..:.|:.....|..|.:.||.|:.|||.::.||...|
Mouse  1088 CEEALKPGECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 16/49 (33%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.