DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG2816 and Wfdc6a

DIOPT Version :9

Sequence 1:	NP_608803.2	Gene:	CG2816 / 33595	FlyBaseID:	FBgn0031564	Length:	84	Species:	Drosophila melanogaster
Sequence 2:	XP_011237710.1	Gene:	Wfdc6a / 209351	MGIID:	2684968	Length:	193	Species:	Mus musculus

Alignment Length:	56	Identity:	21/56 - (37%)
Similarity:	27/56 - (48%)	Gaps:	0/56 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    27 RVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCR 82
            |..:|..|...|.|..|:..:.||.....|..||||||.||.|.|.::..|...|:
Mouse   130 RQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCK 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG2816	NP_608803.2	Kunitz_BPTI	31..82	CDD:278443	19/50 (38%)
Wfdc6a	XP_011237710.1	WAP	89..128	CDD:365870
Wfdc6a	XP_011237710.1	Kunitz_BPTI	133..184	CDD:333766	19/50 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X627
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.810