DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:56 Identity:21/56 - (37%)
Similarity:27/56 - (48%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCR 82
            |..:|..|...|.|..|:..:.||.....|..||||||.||.|.|.::..|...|:
Mouse   130 RQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 19/50 (38%)
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672
Kunitz_eppin 132..188 CDD:438654 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.