DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and T21D12.12

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_499892.1 Gene:T21D12.12 / 188695 WormBaseID:WBGene00020651 Length:183 Species:Caenorhabditis elegans


Alignment Length:38 Identity:18/38 - (47%)
Similarity:24/38 - (63%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRD 83
            |:.::...|.|:||.|.||.||.|||.:|..||..||:
 Worm    41 SFYFHKNTRTCQPFFYQGCDGNSNRFQSKEACESACRN 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 16/34 (47%)
T21D12.12NP_499892.1 Kunitz_BPTI 23..77 CDD:425421 16/35 (46%)
KU 127..182 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.