| Sequence 1: | NP_608803.2 | Gene: | CG2816 / 33595 | FlyBaseID: | FBgn0031564 | Length: | 84 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_741559.3 | Gene: | mec-1 / 188259 | WormBaseID: | WBGene00003165 | Length: | 2007 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 23/51 - (45%) |
|---|---|---|---|
| Similarity: | 30/51 - (58%) | Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2816 | NP_608803.2 | Kunitz_SCI-I-like | 30..81 | CDD:438677 | 22/49 (45%) |
| mec-1 | NP_741559.3 | Kunitz_BPTI | 45..97 | CDD:425421 | |
| EGF_CA | 202..240 | CDD:214542 | |||
| Kunitz-type | <265..304 | CDD:444694 | |||
| Kunitz_TAP-like | 408..472 | CDD:438634 | |||
| Kunitz_TAP-like | 615..675 | CDD:438634 | |||
| Kunitz_TAP-like | 857..915 | CDD:438634 | |||
| Kunitz-type | <1121..1160 | CDD:444694 | |||
| KU | 1261..1311 | CDD:197529 | |||
| Kunitz-type | <1338..1379 | CDD:444694 | |||
| Kunitz-type | 1390..1446 | CDD:438633 | |||
| Kunitz-type | 1458..1514 | CDD:444694 | |||
| Kunitz-type | 1534..1584 | CDD:438633 | 22/49 (45%) | ||
| Kunitz-type | 1597..1654 | CDD:438633 | |||
| Kunitz_BPTI | 1673..1728 | CDD:425421 | |||
| Kunitz-type | 1740..1790 | CDD:438633 | |||
| Kunitz-type | 1798..1849 | CDD:438633 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||