powered by:
Protein Alignment CG2816 and K11D12.6
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504350.1 |
Gene: | K11D12.6 / 187293 |
WormBaseID: | WBGene00019646 |
Length: | 186 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 37/72 - (51%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LLLLIPHHSGAASKRVKLCLQPMISG--RCFGYVE-SYAYNPIKRHCEPFIYGGCGGNDNRFSTK 74
:|||:|...||:..: .:|..|:..| :|..... .|.|:|..:.|.||.|.|||||:|.|:..
Worm 2 ILLLLPFLFGASVSQ-NICDSPVDLGTAKCSNTSSIRYHYDPTVKRCLPFGYTGCGGNENNFADP 65
Fly 75 AECEFNC 81
..|...|
Worm 66 RICRQRC 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.