DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and C02F12.5

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:77 Identity:20/77 - (25%)
Similarity:31/77 - (40%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGLLLLIPHHSGAASKRVKL---CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNR 70
            ||:.|.|:......|.|..:|.   |.:...|.:.:       |:.....|.|:.|.|||...|.
 Worm     6 LLIQLFLVPVLCQYACSSELKFGTACSENKTSTKWY-------YDSKLLFCYPYKYLGCGEGSNS 63

  Fly    71 FSTKAECEFNCR 82
            |.:...|..:|:
 Worm    64 FESNENCLESCK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 12/50 (24%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 11/46 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.