DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and tag-290

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:77 Identity:30/77 - (38%)
Similarity:42/77 - (54%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGLLLLIPHHSGAASKRVKLCLQPMISGR-CFG--YVESYAYNPIKRHCEPFIYGGCGGNDNRF 71
            |:..:||:|..|..       |.||..||. |.|  ...|:.::...:.|:||:|.|||||:|||
 Worm     5 LLVCVLLVPVFSFD-------CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRF 62

  Fly    72 STKAECEFNCRD 83
            ||..||...|::
 Worm    63 STSKECRDACQN 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 24/53 (45%)
tag-290NP_505945.1 Kunitz-type 19..72 CDD:438633 24/52 (46%)
KU 156..211 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.