DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and F22E12.1

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:45 Identity:17/45 - (37%)
Similarity:22/45 - (48%) Gaps:1/45 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRC-FGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            |.| ..:...:.|:.....|..|.||||.||:|||.:..||...|
 Worm    32 GTCELDFHVKWYYDRYDHRCRRFFYGGCEGNENRFDSLEECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 16/43 (37%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 16/43 (37%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.