DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and ZC84.6

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_499035.2 Gene:ZC84.6 / 176299 WormBaseID:WBGene00013849 Length:1491 Species:Caenorhabditis elegans


Alignment Length:54 Identity:23/54 - (42%)
Similarity:30/54 - (55%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRD 83
            :|.||:..|.|...|..|.|:...|.|:.|.|.||.||||.|.|..:|:..||:
 Worm   455 ICTQPLRVGNCDRSVRRYWYSAATRECQSFEYTGCQGNDNNFETLVDCQTFCRN 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 21/50 (42%)
ZC84.6NP_499035.2 KU 230..286 CDD:197529
KU <368..409 CDD:197529
Kunitz_BPTI 455..507 CDD:278443 21/51 (41%)
Lustrin_cystein 515..557 CDD:291299
Kunitz_BPTI 562..616 CDD:278443
Kunitz_BPTI 671..728 CDD:278443
Lustrin_cystein 1003..1046 CDD:291299
EB 1100..1151 CDD:279949
EB 1162..1213 CDD:279949
Endonuclease_V <1390..1409 CDD:294433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.