DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and CG42828

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:76 Identity:29/76 - (38%)
Similarity:41/76 - (53%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFST 73
            ||..||..:.    :|.||...|..|...|:|.|:...:|::..::.|.||::..||||:|||.|
  Fly    10 LLAVLLSTVE----SAEKRKAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNENRFYT 70

  Fly    74 KAECEFNCRDI 84
            |..||..|..|
  Fly    71 KENCEKACATI 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 20/50 (40%)
CG42828NP_001189271.1 KU 27..78 CDD:197529 20/50 (40%)

Return to query results.
Submit another query.