powered by:
Protein Alignment CG2816 and si:dkeyp-73b11.8
DIOPT Version :9
Sequence 1: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373612.1 |
Gene: | si:dkeyp-73b11.8 / 100333708 |
ZFINID: | ZDB-GENE-131120-176 |
Length: | 230 |
Species: | Danio rerio |
Alignment Length: | 53 |
Identity: | 21/53 - (39%) |
Similarity: | 30/53 - (56%) |
Gaps: | 0/53 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 KLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
::|:.|...|:|||:...|.|:|....|:||.:.||.||.|||.:...|...|
Zfish 91 QICVLPREPGQCFGHYLRYYYSPEHHTCKPFYWTGCVGNGNRFLSLNRCNATC 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2816 | NP_608803.2 |
Kunitz_BPTI |
31..82 |
CDD:278443 |
21/51 (41%) |
si:dkeyp-73b11.8 | NP_001373612.1 |
Kunitz_BPTI |
26..77 |
CDD:394972 |
|
KU |
92..143 |
CDD:238057 |
20/50 (40%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X627 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.