DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and col28a2a

DIOPT Version :10

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001153314.2 Gene:col28a2a / 100294690 ZFINID:ZDB-GENE-030131-4444 Length:1208 Species:Danio rerio


Alignment Length:51 Identity:22/51 - (43%)
Similarity:26/51 - (50%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            |....:.|.|..||..:.|......|..|.||||.||||||.|:.||:..|
Zfish  1152 CQLSFVQGSCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTC 1202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 21/49 (43%)
col28a2aNP_001153314.2 VWA 61..242 CDD:459670
gly_rich_SclB <260..>560 CDD:468478
gly_rich_SclB <511..>795 CDD:468478
VWA 816..995 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1152..1202 CDD:438671 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.