DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2816 and col28a2b

DIOPT Version :9

Sequence 1:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_021332654.1 Gene:col28a2b / 100002791 ZFINID:ZDB-GENE-130530-762 Length:1195 Species:Danio rerio


Alignment Length:52 Identity:22/52 - (42%)
Similarity:26/52 - (50%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
            ||...:..|.|..|...:.|.|....|..|.||||.||.|||.|:.||:..|
Zfish  1141 LCKLLLDQGPCREYNIRWYYVPQANACAQFWYGGCEGNRNRFDTEEECKKTC 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 21/51 (41%)
col28a2bXP_021332654.1 vWFA_subfamily_ECM 65..228 CDD:238727
PHA03169 261..>444 CDD:223003
Collagen 311..370 CDD:189968
Collagen 503..562 CDD:189968
Collagen 564..609 CDD:189968
Collagen 732..791 CDD:189968
vWFA 814..1006 CDD:320736
Kunitz_BPTI 1147..1193 CDD:278443 20/46 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.