DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and CG42464

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001162863.1 Gene:CG42464 / 8674117 FlyBaseID:FBgn0259954 Length:87 Species:Drosophila melanogaster


Alignment Length:35 Identity:16/35 - (45%)
Similarity:21/35 - (60%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 FYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |.|:.|...|..|.||||.||:||:..:..||:.|
  Fly    46 FSYHSDKNECLEFSYGGCGGNENRFQTKAICEDLC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 15/33 (45%)
CG42464NP_001162863.1 Kunitz_SCI-I-like 23..80 CDD:438677 15/33 (45%)

Return to query results.
Submit another query.