DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Sfp23F

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001162856.1 Gene:Sfp23F / 8674054 FlyBaseID:FBgn0259949 Length:78 Species:Drosophila melanogaster


Alignment Length:55 Identity:12/55 - (21%)
Similarity:22/55 - (40%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DPKC-LQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            ||.| ::....|.|...:.|..|.:....|.:..:..|..:...:...:.||:.|
  Fly    22 DPSCAVELFGQGACNTLITRIGYLRWENMCTSKNFVACDTDGTSFESIKECEDKC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 9/50 (18%)
Sfp23FNP_001162856.1 Kunitz-type 32..78 CDD:444694 9/45 (20%)

Return to query results.
Submit another query.