DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and TFPI2

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:82 Identity:30/82 - (36%)
Similarity:43/82 - (52%) Gaps:20/82 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSGNKPAVATTTIKPQRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWG 116
            |:||...:               ||.|||.||||..|.|:||::.:::|..|.||||.||.|.:.
Human    28 PTGNNAEI---------------CLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFY 77

  Fly   117 FRQTCEEAC-----IPK 128
            ..:.|::||     :||
Human    78 TWEACDDACWRIEKVPK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 23/49 (47%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659 25/70 (36%)
Kunitz_BPTI 95..149 CDD:425421 30/82 (37%)
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.