DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Spint4

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_084334.1 Gene:Spint4 / 78239 MGIID:1925489 Length:159 Species:Mus musculus


Alignment Length:54 Identity:20/54 - (37%)
Similarity:30/54 - (55%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            || ||..::.|.|.....||:||:.:|.|:.|.:.||.||.|.:..:..|:..|
Mouse    39 DP-CLLDVEPGSCYEVHFRFFYNQTAKQCQIFLFTGCNGNLNNFKLKIDCDVTC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 17/49 (35%)
Spint4NP_084334.1 Kunitz-type 41..91 CDD:438633 17/49 (35%)

Return to query results.
Submit another query.