DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and TFPI

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:125 Identity:34/125 - (27%)
Similarity:56/125 - (44%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLRMTQFLCLAALVLLSLMQLTQAVATPNNNNNNNNNIKPKAVVQVQPGNPSGNKPAVATTTIK 65
            |:..|.:...|.|.|.| |:.|..|....::..:..:.|                   :..|.:.
Human     1 MIYTMKKVHALWASVCL-LLNLAPAPLNADSEEDEEHTI-------------------ITDTELP 45

  Fly    66 PQRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |.:|: ...|....|.|||:..::||::|..::.||.|.||||.||.||:...:.|::.|
Human    46 PLKLM-HSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 20/49 (41%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656 21/54 (39%)
Kunitz_TFPI1_2-like 121..176 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.