DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:80 Identity:27/80 - (33%)
Similarity:34/80 - (42%) Gaps:18/80 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLVPDPK------------------CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNR 114
            |..||.|                  |..|.|.|||...|.|::||:|:..|..|.||||:||.|.
  Rat    62 RQCPDKKRCCFFSCGKKCMDLREDICSLPQDAGPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNN 126

  Fly   115 WGFRQTCEEACIPKK 129
            :.....|...|..|:
  Rat   127 FQSEGICTVVCKKKQ 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 21/49 (43%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672 4/18 (22%)
Kunitz_eppin 85..141 CDD:438654 22/55 (40%)

Return to query results.
Submit another query.