DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and tfpi2

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:93 Identity:33/93 - (35%)
Similarity:48/93 - (51%) Gaps:9/93 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VQVQP---GNPSGNK-----PAVATTTIKPQRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACE 101
            :|.:|   |...||:     |.......||.:.:| ..||..||.|.|..|:.|:|||..:|.||
Zfish   113 MQCEPFTYGGCQGNENNFRNPEECIEYCKPPKTIP-VICLDNLDKGRCSASIPRYYYNSATKTCE 176

  Fly   102 TFKYGGCRGNDNRWGFRQTCEEACIPKK 129
            .|.|.||.|::|.:..:|:|.:.|..|:
Zfish   177 EFMYTGCGGSNNNFISKQSCVDVCGSKR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 22/49 (45%)
tfpi2NP_001035185.1 Kunitz-type 30..80 CDD:438633
Kunitz_TFPI2_2-like 87..140 CDD:438660 6/26 (23%)
Kunitz_TFPI1_TFPI2_3-like 147..200 CDD:438658 23/53 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.