DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and col28a1a

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:101 Identity:33/101 - (32%)
Similarity:44/101 - (43%) Gaps:26/101 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PSGNK--PAVATTTIKPQRLV---------PDPKCLQP---------------LDVGPCRMSLER 90
            |.|||  ...:.:.:.||..:         |.||.|||               ||.||||.....
Zfish  1068 PDGNKTRQQSSISVVGPQTPINWHHVQESSPPPKTLQPPHPDNSLKHVGCGQGLDPGPCREYSVM 1132

  Fly    91 FYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACI 126
            :||:..:.||..|.||||:||.||:.....|:..|:
Zfish  1133 WYYDPQANACAQFWYGGCQGNSNRFETEDICKSTCV 1168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 23/64 (36%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.