DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:55 Identity:25/55 - (45%)
Similarity:33/55 - (60%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIPKK 129
            |..|.|.|||...|.|::||:|:|.|..|.||||:||.|.:..:..|...||.|:
Mouse    95 CSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSICINKR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 22/49 (45%)
Wfdc6bXP_006499938.1 WAP <63..89 CDD:459672
Kunitz_eppin 93..149 CDD:438654 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.