DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and CG42827

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:51 Identity:17/51 - (33%)
Similarity:27/51 - (52%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |||..:.|.|:...:.::||.....|:.|.|..|.||.|.:..:::|.|.|
  Fly    41 CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 16/49 (33%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 16/49 (33%)

Return to query results.
Submit another query.