DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and COL28A1

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:72 Identity:28/72 - (38%)
Similarity:40/72 - (55%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ATTTIKPQRLVP-----DPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQ 119
            ||||.:|....|     ||:||:.|..|.|...:.|:||:|...:|..|.:.||.|:.||:...:
Human  1052 ATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEK 1116

  Fly   120 TCEEACI 126
            .|:|.||
Human  1117 ECQETCI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 18/49 (37%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 6/13 (46%)
Kunitz-type 1072..1122 CDD:444694 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.