DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and CG16713

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:49 Identity:20/49 - (40%)
Similarity:28/49 - (57%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 GPCRMSLERFY----YNKDSKACETFKYGGCRGNDNRWGFRQTCEEACI 126
            |..|:|.|.:.    |:.|...|..|.||||.||:||:..|:.||:.|:
  Fly    33 GDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 19/46 (41%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/46 (41%)

Return to query results.
Submit another query.