DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Wfdc8

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001263361.1 Gene:Wfdc8 / 277343 MGIID:2685552 Length:426 Species:Mus musculus


Alignment Length:63 Identity:24/63 - (38%)
Similarity:32/63 - (50%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DP---KCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC--IPKK 129
            ||   .|:.|.|.|.|:..|.|:|::.....|..|.|.|||||.|.:..:..|..||  :.||
Mouse   121 DPYEEPCMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNACMFVEKK 183

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 18/49 (37%)