DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and AMBP

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:84 Identity:29/84 - (34%)
Similarity:37/84 - (44%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KAVVQVQPGNPSGNKPAVATTTIKPQRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYG 106
            :..|..|....||....|...|.|      :..|......|||.....|::||..|.|||||:||
Human   204 RRAVLPQEEEGSGGGQLVTEVTKK------EDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYG 262

  Fly   107 GCRGNDNRWGFRQTCEEAC 125
            ||.||.|.:...:.|.:.|
Human   263 GCMGNGNNFVTEKECLQTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 21/49 (43%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226 5/19 (26%)
Kunitz_bikunin_1-like 229..282 CDD:438639 22/53 (42%)
Kunitz_bikunin_2-like 284..338 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.